PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10040313
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 154aa    MW: 17595.3 Da    PI: 6.0054
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10040313genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.81.7e-387103197
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                  +Ca+Ck+lrr+Ca+dCvlapyfp ++p++f++vhk+FGasn+ +ll+++p e r +a++++ +eA ar+r+PvyG+vg+i++lqq++ +++ e++ +
  Lus10040313   7 RCAGCKYLRRRCAQDCVLAPYFPPDNPQRFEFVHKIFGASNLARLLQEVPVESRGKAADCMSFEASARVREPVYGCVGMIHELQQEILKVQLEVENI 103
                  6***************************************************************************************999998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.5386107IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-387102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
MSSIGRRCAG CKYLRRRCAQ DCVLAPYFPP DNPQRFEFVH KIFGASNLAR LLQEVPVESR  60
GKAADCMSFE ASARVREPVY GCVGMIHELQ QEILKVQLEV ENIEGMLALH RAEHQLLVMR  120
QQEEKKNMLP DYVDFGAHCN LDLEDDQFLW PLT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316444.22e-48hypothetical protein POPTR_0010s25720g, partial
SwissprotQ8LBW36e-40LBD12_ARATH; LOB domain-containing protein 12
TrEMBLB9HV382e-48B9HV38_POPTR; Uncharacterized protein (Fragment)
STRINGSb07g026800.16e-43(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.14e-41LBD family protein